PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00061.28
Common NameAMTR_s00061p00050690, LOC18447391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family WRKY
Protein Properties Length: 738aa    MW: 79585.6 Da    PI: 5.4851
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00061.28genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.36.4e-33321378260
                                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                              dDgynWrKYGqK+vkgsefprsYY+Ct++gC+vkkkvers+ d++++ei+Y+g H+h+k
  evm_27.model.AmTr_v1.0_scaffold00061.28 321 DDGYNWRKYGQKQVKGSEFPRSYYKCTHPGCQVKKKVERSH-DGQITEIIYKGGHEHPK 378
                                              8****************************************.***************85 PP

2WRKY102.52.4e-32535593159
                                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                              ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++d+k+v++tYeg+Hnh+
  evm_27.model.AmTr_v1.0_scaffold00061.28 535 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNTGCSVRKHVERASHDKKAVITTYEGKHNHD 593
                                              59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081124.352319379IPR003657WRKY domain
SuperFamilySSF1182901.31E-25319379IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.2E-29319379IPR003657WRKY domain
SMARTSM007742.2E-36320378IPR003657WRKY domain
PfamPF031061.9E-25321377IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.6E-37520595IPR003657WRKY domain
SuperFamilySSF1182901.44E-28527595IPR003657WRKY domain
PROSITE profilePS5081138.147530595IPR003657WRKY domain
SMARTSM007741.3E-37535594IPR003657WRKY domain
PfamPF031063.5E-25536593IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 738 aa     Download sequence    Send to blast
MGGIDKNEWT PFFVPNGNFS GIFTEELGSR SLSDLLSENG SQVPVDSNFE KDGNGVSQKI  60
LRDSYGFSCF QPNEEESRSS FMGRLAARTG VSISKINVSN IRSNDPFSSP GVRSPYLMIP  120
PGLSPTTLLE SPVLLSNSTA QPSPTTGTFL FSSFGHGSPV SISAAPDSNT DQLFGDADTS  180
SFAFKSHVNS DSTNLSGGNQ LVHQASSSSK QQQSFPSIDL SVQPEVPIQP QKSVLTEVES  240
QNQERLSYHG EFVKQSTTTA DSIISSSKPE VPSQINESPE CSLLQTQAPI SILESITEEP  300
QNGEEEQKAS IAPIVFGPLS DDGYNWRKYG QKQVKGSEFP RSYYKCTHPG CQVKKKVERS  360
HDGQITEIIY KGGHEHPKPQ PNRRSSVGSS IPLNETSSEM PEGHLALVSA DGESVWKSNQ  420
LGANTIGNDW KGDGIERMST NSLVSEYCDV SSSSQAQTCS HLELADPPEL SSSFSDDEDD  480
GDTHGGMPLG DDGEDDESEA KRRKKDVCTM DVSAASRSIR EPRVVVQTTS EVDILDDGYR  540
WRKYGQKVVK GNPNPRSYYK CTNTGCSVRK HVERASHDKK AVITTYEGKH NHDVPTARNS  600
SHSGSTGAPP TSGGPTASPS AQAHILKPEP AQAHTSMALP PPPKVGQLHT TSSLGAFGQL  660
GPDPGFSMMS QHGFSNLTWA RLGIVPVPPL NSSYINGGGQ QPKSEIKEET GFDSGMPMLN  720
GSGYQQMMRR YQLGPHM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36319595877Probable WRKY transcription factor 4
2lex_A1e-36319595877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006857552.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLU5D9790.0U5D979_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-110WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]